CNTF Recombinant Rat produced in
Escherichia coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22.8 kDa. The CNTF is purified by proprietary chromatographic techniques.
Synonyms: HCNTF, CNTF, Ciliary Neurotrophic Factor.
Formulation: Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 99% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized CNTF in sterile water or 0. 4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Stability: Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Source:Escherichia coli. Amino acid sequence:AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQG
MLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Uniprot ACC#: P20294
Transportation method: Shipped at Room temperature
Safety data sheet: Inquire at info@3hbiomedical.com