Noggin, produced in
Escherichia coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa).
Synonyms: Noggin, SYM1, SYNS1, NOG.
Formulation: Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Source:Escherichia coli.
Amino acid sequence:PIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC.
Uniprot ACC number: P97466
Transportation method: Shipped at room temperature.
Safety data sheet: Inquire at info@3hbiomedical.com