Interleukin-17 A/F, produced in
Escherichia coli is a heterodimeric, non-glycosylated polypeptide comprised of IL17A monomeric subunit & and IL17F monomeric subunit containing a total of 266 amino acids and having a total molecular mass of 29.8kDa. The IL-17 A/F is purified by proprietary chromatographic techniques.
Synonyms: IL17A/F, IL17 A/F, IL-17A/F, IL-17 A/F, IL17AF, IL-17 AF, Interleukin-17 A/F, Interleukin-17 AF.
Formulation: Lyophilized from a concentrated (1mg/ml) solution containing no additives.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97.0% as determined by SDS-PAGE.
Source:Escherichia coli.
Amino acid sequence:EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAAAAIIPQSSACPNTEAKDFLQ NVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA..
Uniprot ACC number:
Transportation method: Shipped at room temperature.
Safety data sheet: Inquire at info@3hbiomedical.com