Ubiquitin-Conjugating Enzyme E2L 3, produced in
E. coli is an 18.9 kDa protein containing 162 amino acids. The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Synonyms: Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.
Formulation: Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Physical Appearance: Sterile Filtered white lyophilized powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD.
Uniprot ACC number: P68036
Transportation method: Shipped at room temperature.
Stability: Lyophilized UBE2L3 although stable at room temperature. Erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at
info@3hbiomedical.com