Ubiquitin Conjugating Enzyme E2B, produced in
E. coli is a 19 kDa protein containing 166 amino acids. The UE2B protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Synonyms: Ubiquitin-conjugating enzyme E2 B, EC 6.3.2.19, Ubiquitin-protein ligase B, Ubiquitin carrier protein B, HR6B, hHR6B, E2-17 kDa UBC2, HHR6B, RAD6B, E2-17 kDa, UBE2B.
Formulation: Lyophilized from a 0.2μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Physical Appearance: Sterile Filtered white lyophilized powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: MHHHHHHAMGQLRSMSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQ
SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS.
Uniprot ACC number: P63146
Transportation method: Shipped at room temperature.
Stability: Lyophilized UBE2B although stable at room temperature. Erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2B should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized UBE2B in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at
info@3hbiomedical.com