Secreted Phospholipase A2-IID, was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined).
Synonyms: Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH 4.
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.
Source:Escherichia coli.Amino acid sequence: MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Uniprot ACC number: Q9UNK4
Transportation method: Shipped at room temperature.
Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at +4°C for a limited period of time; it does not show any change after two weeks at +4°C.
Solubility: Add 0.2 ml of 0.1M Acetate buffer pH 4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited.
Safety data sheet: Inquire at
info@3hbiomedical.com