FKPB1A, fused to N-terminal His-Tag produced in
E. coli is a single, non-glycosylated polypeptide chain purified through a Ni2+-affinity chromatography followed by gel filtration.
Synonyms: FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A.
Formulation: The FKBP1A protein solution contains 50mM Hepes pH 8.0, 150mM NaCl, 0.5mM EDTA & 1mM sodium azide.
Physical Appearance: Sterile Filtered colorless solution.
Purity: Greater than 99.0% as determined by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: The amino acid sequence of recombinant His-tagged FKBP12 is reported as following:MAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHAT
LVFDVELLKLE.
Uniprot ACC number: P62942
Transportation method: Shipped with Ice Packs.
Stability: Store at +4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Safety data sheet: Inquire at
info@3hbiomedical.com