Recombinant human Vascular Endothelial Growth Factor-121 produced in insect cells as an 18 kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36 kDa. VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates. The VEGF-121 is purified by proprietary chromatographic techniques.
Synonyms: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Formulation: The protein was lyophilized from a solution containing 50 mM acetic acid.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS-PAGE.
Source: Sf9, Insect Cells.
Amino acid sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGL
ECVPTEESNITMQIMRIKpH QGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.
Uniprot ACC number: P15692
Transportation method: Shipped at room temperature.
Stability: Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10 ng/ml.
Solubility: The Lyophilized VEGF121 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml.
Safety data sheet: Inquire at info@3hbiomedical.com