Recombinant human TFF-1 produced in
E. coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 is purified by proprietary chromatographic techniques.
Synonyms: TFF-1, TFF1, pS2, BCEI, HPS, HP1. A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Formulation: The Human TFF1 protein was lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4 and 150 mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: EAQTETCTVAPRERQNCGFPG
VTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.
Uniprot ACC number: P04155
Transportation method: Shipped at room temperature.
Stability: Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 µg/ml, corresponding to a specific activity of >100 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com