Recombinant human TGFB2 produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.1 kDa. The TGFB2 is fused to 6xHis-Tag at N-terminus and purified by proprietary chromatographic techniques.
Synonyms: Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Formulation: lyophilized from a concentrated (1mg/ml) solution containing 50 mM Tris-HCl pH 7.4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by SDS-PAGE.
Source: Nicotiana benthamiana.
Amino acid sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCC
VSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
Uniprot ACC number: P61812
Transportation method: Shipped at room temperature.
Stability: Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40 ng/ml, corresponding to a specific activity of 25,000 units/mg.
Solubility: It is recommended to reconstitute the lyophilized TGFB2 in sterile 18MΩ-cm H
2O not less than 1µg/40µl, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com