Recombinant human Extra Cellular Domain Prolactin Receptor produced in
E. coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 24 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.
Synonyms: PRL-R, hPRLrI.
Formulation: The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045 mM NaHCO3.
Physical Appearance: Sterile filtered white Lyophilized powder.
Purity: Greater than 97% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions.
Source:Escherichia coli. Amino acid sequence:LPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYI mMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.
Uniprot ACC number: P16471
Transportation method: Shipped at room temperature.
Stability: Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at +4°C between 2-7 days and for future use below -18°C. For long term storage at +4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Biological Activity: Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio.
Solubility: It is recommended to reconstitute the lyophilized PRLR in sterile 18MΩ-cm H
2O not less than 100 µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com