Recombinant human Pro NGF is the pro-form of the Neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer. Pro-Nerve Growth Factor produced in
E. coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50 kDa. The Pro NGF is purified by proprietary chromatographic techniques.
Synonyms: Human Pro-NGF, ProNGF, NGFB.
Formulation: ProNGF was lyophilized from a 0.2 µM filtered solution of 20 mM PB and 250 mM NaCl pH 7.2.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MEpH SESNVPAGHTIPQ
AHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.
Uniprot ACC number: P01138
Transportation method: Shipped at room temperature.
Stability: Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
References: Title: ProNGF inhibits NGF mediated TrkA activation in PC12 cells. Publication: Journal of neurochemistry 107 .5 (2008): 1294-1303. Link: http://onlinelibrary. wiley. com/doi/10.1111/j.1471-4159.2008.05690. x/epdf
Safety data sheet: Inquire at info@3hbiomedical.com