Recombinant human OPG is a single, glycosylated polypeptide chain containing 393 amino acids (22-401a.a.) and having a molecular mass of 45.0 kDa (calculated). OPG is fused to a 13 a.a. FLAG- tag at N-terminal.
Synonyms: TNFRSF11B, OPG, OCIF, Osteoclastogenesis inhibitory factor, Osteoprotegerin, TR1, MGC29565.
Formulation: OPG filtered (0.4 µm) and lyophilized from 0.5 mg/ml solution in PBS, pH 7.5 and 5% (w/v) Trehalose.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 90% as determined by SDS-PAGE.
Source: HEK293 Cells.
Amino acid sequence: PGDYKDDDDKPAGETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYC SPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAP CRKHTNCSVFGLLLTQKGNATHDNICS
GNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQ
Uniprot ACC number: O00300
Transportation method: Shipped at room temperature.
Stability: Store Lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at +4°C for a limited period of time; it does not show any change after two weeks at +4°C.
Solubility: It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the Lyophilized pellet dissolve completely.
Safety data sheet: Inquire at info@3hbiomedical.com