Recombinant human Osteopontin is a single, glycosylated, polypeptide chain produced in HEK293 cells, is a full length protein (amino acids 17-314) fused with a polyhistidine tag at the C-terminus, having a total calculated molecular mass of 34.5 kDa (The actual molecular mass may be approximately 60-65 kDa in SDS-PAGE under reducing conditions due to glycosylation). Osteopontin is purified by proprietary chromatographic techniques.
Synonyms: Secreted pH ospH oprotein-1, OPN, BNSP, BSPI, ETA-1, MGC1109 40, SPP-1, Osteopontin, Bone sialoprotein 1, Urinary stone protein, NepH ropontin, Uropontin, SPP1.
Formulation: Osteopontin was lyophilized from a 0.2 µm filtered solution of 20 mM PB and 150 mM NaCl, pH 7.2.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS-PAGE.
Source: HEK293 cells.
Amino acid sequence: IPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDMDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPD
ATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKandESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASSEVNVDHHHHHH.
Uniprot ACC number: P10451
Transportation method: Shipped at room temperature.
Stability: Store at +4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized SPP1 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com