Recombinant human Oncostatin-M (209 a.a.) produced in
E. coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9 kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.
Synonyms: OSM, MGC20461, Oncostatin M.
Formulation: Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH 7.4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQP
PTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSpH QALRKGVRR.
Uniprot ACC number: P13725
Transportation method: Shipped at room temperature.
Stability: Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is < 2 ng/ml, corresponding to a Specific Activity of 500,000 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com