Recombinant human Noggin produced in
E. coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.3 kDa (each chain 23.15 kDa). Noggin is purified by proprietary chromatographic techniques.
Synonyms: SYM1, SYNS1, NOG.
Formulation: lyophilized from a 0.2μm filtered solution in 30% CH3CN, 0.1% TFA.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Uniprot ACC number: Q13253
Transportation method: Shipped at room temperature.
Stability: Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Noggin should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The ED50 was determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline pH ospH atase production by murine ATDC-5 cells. The expected ED50 for this effect is < 3 ng/ml of Noggin, corresponding to a Specific Activity of 3.3x105 units/mg.
Solubility: It is recommended to be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HAc to a concentration of 0.1-1.0 mg/mL. Further dilutions should be made in appropriate buffered solutions.
Safety data sheet: Inquire at info@3hbiomedical.com