Recombinant human Melanoma Inhibitory Activity produced in
E. coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12.2 kDa. The MIA is purified by proprietary chromatographic techniques.
Synonyms: Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA.
Formulation: The protein was lyophilized from a concentrated (1mg/ml) solution containing 20 mM Potassium-phosphate pH 7 and 150 mM potassium chloride.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ.
Uniprot ACC number: Q16674
Transportation method: Shipped at room temperature.
Stability: Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIA should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay.
Solubility: It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com