Recombinant human MIF, fused to His-tag at C-terminus, was cloned into an
E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
Synonyms: pH enylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, mMIF, MIF.
Formulation: Human MIF was lyophilized from a 1mg/ml solution containing PBS pH 7.4.
Physical Appearance: Sterile Filtered Lyophilized powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRV
YINYYDMNAANVGWNNSTFALEHHHHHH.
Uniprot ACC number: P14174
Transportation method: Shipped at room temperature.
Stability: Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: Measured by its ability to bind rhCD74 in a functional ELISA.
Solubility: It is recommended to reconstitute the lyophilized MIF in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com