Recombinant human MIF was cloned into an
E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.
Synonyms: pH enylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, mMIF, MIF.
Formulation: MIF-Protein was lyophilized from 10 mM sodium phosphate buffer pH 7.5.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRV
YINYYDMNAANVGWNNSTFA.
Uniprot ACC number: P14174
Transportation method: Shipped at room temperature.
Stability: Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: Human PBMCs were cultured with 0 to 1000 ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132 ng/ml.
Solubility: It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H
2O at a concentration between 0.1mg-1mg per 1ml.
Safety data sheet: Inquire at info@3hbiomedical.com