Recombinant human LIF produced in yeast is a single, glycosylated polypeptide chain containing 180 amino acids and having a molecular mass of 58.5 kDa. The LIF is purified by proprietary chromatographic techniques.
Synonyms: CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA.
Formulation: The protein was lyophilized from a 0.2 µm filtered PBS.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 98% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source: Pichia pastoris.
Amino acid sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKD
VFQKKKLGCQLLGKYKQIIAVLAQAF.
Uniprot ACC number: P15018
Transportation method: Shipped at room temperature.
Stability: Lyophilized LIF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution LIF should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: The biological activity of recombinant human LIF was measured by the ability to induce differentiation of murine M1 myeloid leukemic cells. The minimal detectable concentration of human LIF in this assay is <0.05 ng/ml. The specific activity is > 1 x 108 units/mg.
Solubility: It is recommended to reconstitute the lyophilized LIF in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com