Recombinant human Interleukin-12 produced in HEK cells is a glycosylated heterodimer, having a total molecular weight of 57 kDa. The IL12 is purified by proprietary chromatographic techniques.
Synonyms: NKSF, CTL maturation factor (TCMF), Cytotoxic Lymphocyte maturation factor (CLMF), TSF, Edodekin-Alpha, IL-12.
Formulation: IL12 was lyophilized from a 0.2 µm filtered solution containing 1xPBS.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as obsereved by SDS-PAGE.
Source: HEK.
Amino acid sequence: IL-12 is a heterodimer of IL-12A and IL-12B linked through a disulfide-bond between cysteines in red in sequences below. >IL-12 ARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSF mMALCLSSIYEDLKMYQVEFKTMN
AKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS>IL-12BIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTpH SYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS.
Uniprot ACC number:Transportation method: Shipped at room temperature.
Stability: Lyophilized IL-12 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL12 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The specific activity was determined by the dose-dependent release of IFN-gamma from the human NK92 cell line in presence of 20 ng/ml rIL-2. The EC50 is 0.5 ng/ml.
Solubility: It is recommended to reconstitute the lyophilized IL12 in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Safety data sheet: Inquire at info@3hbiomedical.com