Recombinant human Interleukin-1 Alpha produced in
E. coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18 kDa. The IL-1A is purified by proprietary chromatographic techniques.
Synonyms: Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 Alpha, IL1, IL-1A, IL1F1.
Formulation: The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25 mM Tris-HCl, pH 8.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLY
VTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA.
Uniprot ACC number: P01583
Transportation method: Shipped at room temperature.
Stability: Lyophilized Interleukin-1 Alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 10
9 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized Interleukin 1 Alpha in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at
info@3hbiomedical.com