Recombinant Human Neuregulin-1 beta 2 produced in
E. coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7.0 kDa. NRG-1 is purified by proprietary chromatographic techniques.
Synonyms: Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
Formulation: lyophilized from a 0.2 µm filtered solution in PBS, pH 7.4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ.
Uniprot ACC number: Q02297
Transportation method: Shipped at room temperature.
Stability: Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Heregulin should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: The ED50 as determined by a cell proliferation assay using serum free human MCF-7 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized NRG1 in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
References: Title:Serine Protease Inhibitor Kazal Type 1 Promotes Proliferation of Pancreatic Cancer Cells through the Epidermal Growth Factor Receptor. Publication:Published OnlineFirst September 8, 2009; doi: 10.1158/1541-7786. MCR-08-0567 Mol Cancer Res September 2009 7; 1572. Link: http://mcr. aacrjournals. org/content/7/9/1572. full
Safety data sheet: Inquire at info@3hbiomedical.com