Recombinant human Glia Maturation Factor-Beta (GMF-Beta) produced in
E. coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, is purified by proprietary chromatographic techniques.
Synonyms: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF.
Formulation: The GMF-beta protein was Lyophilized after dialysis against 20 mM PBS pH 7.4 and 130 mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 98% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQ mMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH.
Uniprot ACC number: P60983
Transportation method: Shipped at room temperature.
Stability: Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized GMFB in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com