Recombinant human FGF-2 Thermostable produced in HEK cells is a non-glycosylated monomer, containing 154 amino acids and having a total molecular weight of 17 kDa. FGF-2 Thermostable is a protein engineered FGF2 in order to enhance its thermostability without modifying its biological function. The FGF-b is purified by proprietary chromatographic techniques.
Synonyms: Prostatropin, HBGH-2, HBGF-2, FGF-2, FGF-b.
Formulation: The FGF2 was filtered (0.2µm) and lyophilized from 1.26mg/ml in 1xPBS.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as obsereved by SDS-PAGE.
Source: HEK.
Amino acid sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDpH IKLQLQAEERGV VSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYK.
Uniprot ACC number: P09038
Transportation method: Shipped at room temperature.
Stability: Lyophilized FGF-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-b should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The specific activity was determined by the dose dependent stimulation of proliferation of the Balb/c 3T3 cell line, the ED50 is 0.03 ng/ml.
Solubility: It is recommended to reconstitute the lyophilized FGF-b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Safety data sheet: Inquire at info@3hbiomedical.com