Recombinant human Fibroblast Growth Factor-23 produced in
E. coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis-Tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His-Tag) and having a molecular mass of 28.6 kDa. The FGF-23 is and purified by chromatographic techniques.
Synonyms: Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, pH PTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
Formulation: The protein (0.5 mg/ml) was lyophilized from 25 mM Tris pH 7.5 and 0.6M NaCl solution.
Physical Appearance: Sterile Filtered white Lyophilized powder.
Purity: Greater than 90% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLC
MDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH.
Uniprot ACC number: Q9GZV9
Transportation method: Shipped at room temperature.
Stability: Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels.
Solubility: It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-23 in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com