Recombinant human EBI3 produced in
E. coli is a single, non-glycosylated, polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3 kDa. The EBI3 is purified by proprietary chromatographic techniques.
Synonyms: Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.
Formulation: EBI3 Human Recombinant was lyophilized from a solution containing 10 mM Acetic Acid and 0.5% Mannitol.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 90% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence:LNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
Uniprot ACC number: Q14213
Transportation method: Shipped at room temperature.
Stability: Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Solubility: It is recommended to reconstitute the lyophilized EBI3 in sterile 10 mM Acetic acid not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com