Recombinant human Bone Morphogenetic Protein-7 produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5 kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
Synonyms: Osteogenic Protein 1, BMP-7.
Formulation: BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by SDS-PAGE.
Source: Nicotiana benthamiana.
Amino acid sequence: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Uniprot ACC number: P18075
Transportation method: Shipped at room temperature.
Stability: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The biological activity of BMP-7 was measured by its ability to induce alkaline pH ospH atase production by ATDC5 cells, ED50 is less than 40 ng/ml, corresponding to a specific activity of 25,000 units/mg.
Solubility: Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/µl.
Safety data sheet: Inquire at info@3hbiomedical.com