Recombinant human BMP-4 produced in HEK cells is a glycosylated disulfide linked homodimer, having a total molecular weight of 34 kDa. The BMP-4 is purified by proprietary chromatographic techniques.
Synonyms: BMP4, ZYME, BMP2B, BMP2B1.
Formulation: The BMP-4 was lyophilized from 1.07mg/ml in 2xPBS+6% ethanol.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as obsereved by SDS-PAGE.
Source: HEK.
Amino acid sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNST NHAIVQTLVNSVNSSIPKAC
CVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR.
Uniprot ACC number: P12644
Transportation method: Shipped at room temperature.
Stability: Lyophilized BMP4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-4 should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Biological Activity: The specific activity was determined by the dose dependent induction of alkaline pH ospH atase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 2.9 ng/ml corresponding to a Specific Activity of 220, 750.55IU/mg.
Solubility: It is recommended to reconstitute the lyophilized BMP-4 in sterile 4 mM HCl containing 0.1% endotoxin-free recombinant HSA.
Safety data sheet: Inquire at info@3hbiomedical.com