Recombinant human B-type Natriuretic Peptide produced in
E. coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3.4 kDa. NPPB is purified by proprietary chromatographic techniques.
Synonyms: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.
Formulation: Natriuretic Peptide Precursor B was lyophilized from 0.4 Ml PBS buffer containing 20 mM phosphate buffer and 0.6 mM sodium chloride.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Uniprot ACC number: P16860
Transportation method: Shipped at room temperature.
Stability: Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at +4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com