Recombinant human B Lymphocyte Stimulator Receptor extracellular produced in
E. coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa. The BAFF-R is purified by proprietary chromatographic techniques.
Synonyms: TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Formulation: lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20 mM PB, pH 8.0, 500 mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Uniprot ACC number: Q96RJ3
Transportation method: Shipped at room temperature.
Stability: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0 µg/ml of human soluble BAFF.
Solubility: It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com