Recombinant human The AIF1 contains a total of 155 amino acids having a molecular Mass of 17.7 kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His-Tag.
Synonyms: AIF-1, Allograft Inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1.
Formulation: Filtered and lyophilized from 0.5 mg/ml in 20 mM Tris buffer and 50 mM NaCl pH 7.5.
Physical Appearance: Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 90% as determined by SDS PAGE.
Source:E. coli.
Amino acid sequence: MKHHHHHHASQTRDLQGGKAFGLLK
AQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLR mMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP.
Uniprot ACC number: P55008
Transportation method: Shipped at room temperature.
Stability: For long term, store Lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at +4°C for a limited period of time; it does not show any change after two weeks at +4°C. The Lyophilized protein remains stable for 24 months when stored at -20°C.
Solubility: Add 0.2 ml of deionized water and let the Lyophilized pellet dissolve completely.
Safety data sheet: Inquire at info@3hbiomedical.com