MIG (monokine induced by gamma-IFN) Human Recombinant produced in
E. coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11.7 kDa. The MIG is purified by proprietary chromatographic techniques.
Synonyms: Small inducible cytokine B9, CXCL9, Gamma INF-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-IFN.
Formulation: Lyophilized from a 0.2 μm filtered concentrated (1.0 mg/ml) solution in 20 mM PB, pH 7.4, 50mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNG
KKHQKKKVLKVRKSQRSR QKKTT
Uniprot ACC number: Q07325
Transportation method: Shipped at room temperature.
Stability: Lyophilized MIG although stable at room temperature.erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Biological Activity: Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized MIG in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com