HCC-1 Human Recombinant produced in
E. coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8.4 kDa. The HCC-1 is purified by proprietary chromatographic techniques.
Synonyms: Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.
Formulation: The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN.
Uniprot ACC number: Q16627
Transportation method: Shipped at room temperature.
Stability: Lyophilized HCC1 although stable at room temperature.erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Biological Activity: The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com