Fractalkine Human Recombinant- produced in
E. coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8.6 kDa. The Fractalkine is purified by proprietary chromatographic techniques.
Synonyms: Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.
Formulation: The CX3CL1 was lyophilized from a 0.2μm filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.
Uniprot ACC number: P78423
Transportation method: Shipped at room temperature.
Stability: Lyophilized CX3CL1 although stable at room temperature.erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Biological Activity: The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
References: Title: Glial Cell Line-Derived Neurotrophic Factor and Neurturin Inhibit Neurite Outgrowth and Activate RhoA through GFR alpha 2b, an Alternatively Spliced Isoform of GFR alpha 2.Publication: The Journal of Neuroscience, 23 May 2007, 27(21): 5603-5614; doi: 10.1523/?JNEUROSCI.4552-06.2007.Link: http://www.jneurosci.org/content/27/21/5603.fullApplications: GFR alpha 2 when activated by NTN, it inhibits neurite outgrowth induced by GFR alpha 1a, GFR alpha 2a, and GFR alpha 2c isoforms.
Safety data sheet: Inquire at info@3hbiomedical.com