CCL24 Human Recombinant produced in
E. coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques.
Synonyms: C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.
Formulation: The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 97% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source:Escherichia coli.Amino acid sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
Uniprot ACC number: O00175
Transportation method: Shipped at room temperature.
Stability: Lyophilized Eotaxin-2 although stable at room temperature.erature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Biological Activity: The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000 IU/mg.
Solubility: It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H
2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com