Synonyms: Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Formulation: Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 98%.
Antigen Amino Acid Sequence: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Transportation method: Shipped with Ice Packs.
Stability: Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.
Purification Method: Purified IgG prepared by affinity chromatography on protein G.
Immunogen: IgG Anti Human TGFb-2 is developed in rabbit using recombinant Human TGFb-2 produced in plants.
Solubility: Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Type: Polyclonal Rabbit Antibody.
Safety data sheet: Inquire at info@3hbiomedical.com