Synonyms: Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.
Formulation: Lyophilized from 0.2μm sterile filtered solution in phosphate buffered saline, pH 7.4.
Purity: Greater than 98.0% as determined by Analysis by SDS-PAGE.
Antigen Amino Acid Sequence:PLMNEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Transportation method: Shipped with Ice Packs.
Stability: Store at -20°C. For long term storage freezes in working aliquots at -20°C. Repeated freezing and thawing is not recommended.
Purification Method: Purified IgG prepared by affinity chromatography on protein G.
Immunogen: IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.
Solubility: Reconstitute with H20. Mix gently, wash the sides of the vial and wait 30-60 seconds before use.
Type: Polyclonal Rabbit Antibody.
Safety data sheet: Inquire at info@3hbiomedical.com