Recombinant human Galectin-7 produced in
E. coli is a single, non-glycosylated, Polypeptide chain containing 136 amino acids and having a molecular mass of 15 kDa. The LGALS7 is purified by proprietary chromatographic techniques.
Synonyms: Galectin-7, Gal-7, HKL-14, PI7, p53-induced gene 1 protein, LGALS7, PIG1, LGALS7B, GAL7, LGALS7A.
Formulation: LGALS7 was lyophilized from a concentrated (1mg/ml) solution in 20 mM Tris, 150 mM NaCl, 1 mM EDTA and 5% Trehalose, pH 8.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Purity: Greater than 95% as determined by SDS-PAGE.
Source:Escherichia coli. Amino acid sequence: MSNVpH KSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Uniprot ACC number: P47929
Transportation method: Shipped at room temperature.
Stability: Lyophilized LGALS7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Galectin-7 should be stored at +4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Solubility: It is recommended to reconstitute the lyophilized Galectin-7 in sterile distilled H
2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Safety data sheet: Inquire at info@3hbiomedical.com